2.50 Rating by CuteStat

enelsan.com is 2 decades 1 year old. It is a domain having com extension. It has a global traffic rank of #8140709 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, enelsan.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 103
Daily Pageviews: 206

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 220
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 720,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 8,140,709
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948
Enelsan | We Measure - Ölçeriz

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 28 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 22
Google Adsense: Not Applicable Google Analytics: UA-64470200-1

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 14 Dec 2019 20:36:04 GMT
Server: Apache/2
X-Powered-By: PHP/5.6.40
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://enelsan.com/xmlrpc.php
Link: <http://enelsan.com/wp-json/>; rel="https://api.w.org/", <http://enelsan.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Nimzo 27, LLC
Registration Date: Jul 23, 2002, 2:40 PM 2 decades 1 year 9 months ago
Expiration Date: Jul 23, 2021, 2:40 PM 2 years 9 months 3 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
enelsan.com A 14400 IP: 77.92.140.32
enelsan.com NS 14400 Target: ns1.kotuhost.com
enelsan.com NS 14400 Target: ns2.kotuhost.com
enelsan.com SOA 10800 MNAME: ns1.kotuhost.com
RNAME: mesutbilgili.outlook.com
Serial: 2019082103
Refresh: 14400
Retry: 3600
Expire: 1209600
Minimum TTL: 86400
enelsan.com MX 14400 Priority: 10
Target: alt3.aspmx.l.google.com
enelsan.com MX 14400 Priority: 10
Target: alt4.aspmx.l.google.com
enelsan.com MX 14400 Priority: 1
Target: aspmx.l.google.com
enelsan.com MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
enelsan.com MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com
enelsan.com TXT 14400 TXT: v=spf1 a mx ip4:212.68.61.160 ~all

Similarly Ranked Websites

gonaturalgiveaways.com -&nbspThis website is for sale! -&nbspgonatural

- gonaturalgiveaways.com

This website is for sale! gonaturalgiveaways.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, gonaturalgiveaways.com has it all. We hope you find what you are searching for!

8,140,715 $ 240.00

Ok Porn Videos | Free Mobile Porn Videos, Porn Sex Clips

- okpornvideos.com

Admire exclusive content with XXX adult videos and chinese porn movies from Ok Porn Videos. Magnificent chicks are always ready to take part in various kinds of free XXX movies.

8,140,720 $ 240.00


Muttakilik Sosyal Bilinçlenme Platformu Muttakilik

- muttakilik.com

Muttakilik sitesi kavramlar ve insan üzerine düşüncelerin yayımlandığı bir sosyal sitedir.

8,140,737 $ 240.00

الشيخة السعدية

- alsadyh.space

الشيخة السعدية ​جلب الحبيب - رد الحبيب - ارجاع الحبيب - جلب الزوج الزعلان - رد المطلقة لزوجها - زواج العانس - فك سحر التفريق - فك السحر الاسود - فك السحر الهوائي - علاج القرين والتابعة - علاج للوهم والوسواس - علاج جميع صدمات الجن - علاج

8,140,743 $ 240.00

Full WHOIS Lookup

Domain Name: ENELSAN.COM
Registry Domain ID: 88650921_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2019-08-20T02:18:08Z
Creation Date: 2002-07-23T08:55:32Z
Registrar Registration Expiration Date: 2021-07-23T08:55:32Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Muhammed GOKGOL
Registrant Organization: ENELSAN End.Elekt.San.Anonim Sti.
Registrant Street: Dosb 1. Kısım Dicle Cad. No:46 Dilovası KOCAELI
Registrant City: KOCAELI
Registrant State/Province: Kocaeli
Registrant Postal Code: 41455
Registrant Country: TR
Registrant Phone: +90.902627546313
Registrant Phone Ext:
Registrant Fax: +90.902627546313
Registrant Fax Ext:
Registrant Email: mgokgol@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Muhammed GOKGOL
Admin Organization: ENELSAN End.Elekt.San.Anonim Sti.
Admin Street: Dosb 1. Kısım Dicle Cad. No:46 Dilovası KOCAELI
Admin City: KOCAELI
Admin State/Province: Kocaeli
Admin Postal Code: 41455
Admin Country: TR
Admin Phone: +90.902627546313
Admin Phone Ext:
Admin Fax: +90.902627546313
Admin Fax Ext:
Admin Email: mgokgol@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Muhammed GOKGOL
Tech Organization: ENELSAN End.Elekt.San.Anonim Sti.
Tech Street: Dosb 1. Kısım Dicle Cad. No:46 Dilovası KOCAELI
Tech City: KOCAELI
Tech State/Province: Kocaeli
Tech Postal Code: 41455
Tech Country: TR
Tech Phone: +90.902627546313
Tech Phone Ext:
Tech Fax: +90.902627546313
Tech Fax Ext:
Tech Email: mgokgol@gmail.com
Name Server: ns1.kotuhost.com
Name Server: ns2.kotuhost.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-14T20:41:13Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: INFRA TEKNOLOJI HOSTING INTERNET HIZMETLERI

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.